DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33865 and H2ac23

DIOPT Version :9

Sequence 1:NP_001027386.1 Gene:His2A:CG33865 / 3772505 FlyBaseID:FBgn0053865 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001171015.1 Gene:H2ac23 / 665433 MGIID:2448302 Length:130 Species:Mus musculus


Alignment Length:122 Identity:109/122 - (89%)
Similarity:116/122 - (95%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:|||||||||:||||||||||||||:|||.||:||
Mouse     1 MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE 121
            |||||||||||||||||||||||||||||||||..||||||||||||||||||||||
Mouse    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33865NP_001027386.1 PTZ00017 16..124 CDD:185399 97/106 (92%)
H2ac23NP_001171015.1 PTZ00017 1..130 CDD:185399 109/122 (89%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 14/20 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.