DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33865 and hta2

DIOPT Version :9

Sequence 1:NP_001027386.1 Gene:His2A:CG33865 / 3772505 FlyBaseID:FBgn0053865 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_594421.1 Gene:hta2 / 2542226 PomBaseID:SPAC19G12.06c Length:131 Species:Schizosaccharomyces pombe


Alignment Length:124 Identity:100/124 - (80%)
Similarity:109/124 - (87%) Gaps:2/124 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGKGGK--VKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVL 63
            |||...|||  |...|:|||.:|||.|||||:||||||||||:|||||||||||||:||||||:|
pombe     1 MSGGKSGGKAAVAKSAQSRSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEIL 65

  Fly    64 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122
            ||||||||||||||||||||||||||||||||||..||||||||:|||.|.||||::.|
pombe    66 ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPKQSGK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33865NP_001027386.1 PTZ00017 16..124 CDD:185399 92/107 (86%)
hta2NP_594421.1 PTZ00017 4..130 CDD:185399 97/121 (80%)
H2A 5..120 CDD:238029 94/114 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 137 1.000 Domainoid score I1241
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I1047
OMA 1 1.010 - - QHG53554
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm9306
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - LDO PTHR23430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2143
SonicParanoid 1 1.000 - - X55
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.