DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33865 and hist1h2a10

DIOPT Version :9

Sequence 1:NP_001027386.1 Gene:His2A:CG33865 / 3772505 FlyBaseID:FBgn0053865 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001373597.1 Gene:hist1h2a10 / 100332885 ZFINID:ZDB-GENE-131127-92 Length:128 Species:Danio rerio


Alignment Length:123 Identity:110/123 - (89%)
Similarity:118/123 - (95%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:||||||||||:|||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33865NP_001027386.1 PTZ00017 16..124 CDD:185399 98/107 (92%)
hist1h2a10NP_001373597.1 PTZ00017 1..128 CDD:185399 110/123 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4548
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3500
OMA 1 1.010 - - QHG53554
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000046
OrthoInspector 1 1.000 - - mtm6415
orthoMCL 1 0.900 - - OOG6_100077
Panther 1 1.100 - - O PTHR23430
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X55
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.