DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33865 and si:ch73-368j24.13

DIOPT Version :10

Sequence 1:NP_001027386.1 Gene:His2A:CG33865 / 3772505 FlyBaseID:FBgn0053865 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_001334871.2 Gene:si:ch73-368j24.13 / 100000574 ZFINID:ZDB-GENE-160113-30 Length:261 Species:Danio rerio


Alignment Length:125 Identity:111/125 - (88%)
Similarity:119/125 - (95%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:||||||||||:|||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||||.|
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33865NP_001027386.1 PTZ00017 16..124 CDD:185399 98/107 (92%)
si:ch73-368j24.13XP_001334871.2 PTZ00017 1..128 CDD:185399 111/125 (89%)
PTZ00017 135..261 CDD:185399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.