DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG14518

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:80 Identity:20/80 - (25%)
Similarity:37/80 - (46%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SNAFVQL-FELRRINFCEFLSEYNTNPMMEMMFKKNVKL-NDIIVCPVRVGNYSLLNSDIAENIH 155
            :||.::: :||    |.|:.:..:|.|.:.:...||..| ::.:..|:..|.| ||..|...|..
  Fly   102 NNALIRIVWEL----FKEYSTINHTCPYVGLQQVKNFYLRSEKLPTPIPTGEY-LLMIDWVFNKK 161

  Fly   156 ADGVQNGTYRFFAEI 170
            .....|..:.|..::
  Fly   162 PQAATNVYFTFVEDL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 18/77 (23%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 19/75 (25%)

Return to query results.
Submit another query.