DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33632

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:164 Identity:35/164 - (21%)
Similarity:59/164 - (35%) Gaps:63/164 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KAVVAIKQIHVFGESNYMKAKIY------------IHEDRSHFD-LHVQLVHELGSNHLIMNIKV 86
            |..||.:.|.:     |...::|            :.:|.|.|: .::|.|:.   ::..:::||
  Fly     6 KLCVAFQLICI-----YYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNR---SYKYVSLKV 62

  Fly    87 R-VKPEGSNAFVQLFELRRIN------------FCEFLSEYNTNPMM------------------ 120
            : :|...:...||....:|:|            .|.||...|.||:.                  
  Fly    63 KLLKIPVTKIKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCP 127

  Fly   121 --------EMMFKK-NVKLNDIIVCPVRVGNYSL 145
                    ||.:.. |.||.:|:  |...|||.|
  Fly   128 YNHDLVLDEMSYHSINYKLTEIL--PFPEGNYKL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 21/89 (24%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 18/82 (22%)

Return to query results.
Submit another query.