DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG12849

DIOPT Version :9

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:138 Identity:27/138 - (19%)
Similarity:48/138 - (34%) Gaps:48/138 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DRSHFDLHVQLVHELGSNHLIMNIKV---RVKPEGSNAFVQL--FELRRI--NF------CEFLS 112
            ||...|.....:..:...:..:::|.   |:..:......||  .|.||:  ||      |:|:.
  Fly    32 DRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRENRRVLYNFDFKVDSCKFMR 96

  Fly   113 EYNTNPMMEMMFKKNVKLNDIIVCPVRVGNYSLLN-------------------SDIAENIHADG 158
            :           :|:|..|.:.   ...|.||.||                   :.:.::|..||
  Fly    97 D-----------RKHVIANWVY---QTFGPYSNLNHTCPYDHDIVLDKLPVQHLNKLVQSIIPDG 147

  Fly   159 --VQNGTY 164
              :.|.|:
  Fly   148 RYMMNSTW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 22/100 (22%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.