DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33687

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:142 Identity:30/142 - (21%)
Similarity:54/142 - (38%) Gaps:37/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FGESNYMKAKIYIHEDRSHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEF 110
            ||.....:.|. ::....:.|::::| :.|..|::::.:..:   ..:|.:...|.....:||::
  Fly    26 FGNFEMCRIKA-VNRTHKYIDINLKL-YILPINNIMIKLDSK---RYTNGYRPFFMSLTFDFCKY 85

  Fly   111 LSEYNTNPMMEMMFKKNV--------KLNDIIVCPVRVGNYSLLNSDIAENIHADG--------- 158
            |...|   ...|:|.|.:        .||.  .||        .|:||..|....|         
  Fly    86 LKNPN---QRSMIFLKEIHSTFINASNLNH--TCP--------YNNDITVNKFWTGNLERAFLRY 137

  Fly   159 --VQNGTYRFFA 168
              |.||.|..|:
  Fly   138 LPVPNGDYAIFS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 22/92 (24%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:461928 22/98 (22%)

Return to query results.
Submit another query.