DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33687

DIOPT Version :9

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001027130.2 Gene:CG33687 / 3772322 FlyBaseID:FBgn0053687 Length:169 Species:Drosophila melanogaster


Alignment Length:142 Identity:30/142 - (21%)
Similarity:54/142 - (38%) Gaps:37/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FGESNYMKAKIYIHEDRSHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEF 110
            ||.....:.|. ::....:.|::::| :.|..|::::.:..:   ..:|.:...|.....:||::
  Fly    26 FGNFEMCRIKA-VNRTHKYIDINLKL-YILPINNIMIKLDSK---RYTNGYRPFFMSLTFDFCKY 85

  Fly   111 LSEYNTNPMMEMMFKKNV--------KLNDIIVCPVRVGNYSLLNSDIAENIHADG--------- 158
            |...|   ...|:|.|.:        .||.  .||        .|:||..|....|         
  Fly    86 LKNPN---QRSMIFLKEIHSTFINASNLNH--TCP--------YNNDITVNKFWTGNLERAFLRY 137

  Fly   159 --VQNGTYRFFA 168
              |.||.|..|:
  Fly   138 LPVPNGDYAIFS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 22/92 (24%)
CG33687NP_001027130.2 DUF1091 64..147 CDD:284008 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.