DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33798

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:151 Identity:29/151 - (19%)
Similarity:59/151 - (39%) Gaps:32/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MEYSTSPKKAVVAIKQIHV---------------FGESNYMKAKIYIHEDRSHFDLHVQLVHELG 76
            |.:|......:..|:::|.               |.:..|.:.| .::....:..|.|.| .:..
  Fly     1 MIFSVGFLVTIFLIRKVHSLVEITNFECESLDRNFSDFEYCRLK-SVNRTYKYISLKVHL-FQTP 63

  Fly    77 SNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEM---MFKKNVKLNDIIVCPV 138
            .|.:.:|..:..:..|...|  |:.: .::.|:|:...|:||:.:.   :||....:|.  .|| 
  Fly    64 VNQIKVNTAIYKRLNGYKPF--LYNV-TVDGCKFIKNQNSNPVTKFIFGVFKDATNMNH--SCP- 122

  Fly   139 RVGNYSLLNSDIAENIHADGV 159
                |.  :..|.|.:.|:.:
  Fly   123 ----YD--HDIIMEKLSAESI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 16/67 (24%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 18/81 (22%)

Return to query results.
Submit another query.