DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33775

DIOPT Version :9

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:134 Identity:29/134 - (21%)
Similarity:49/134 - (36%) Gaps:50/134 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GSNAFVQLFE------------LRRIN-FCEFLSEYNT-------NP-------MMEMMFKKNVK 129
            |::.:::||:            .||.| |..||...:|       ||       ::....||...
  Fly    61 GADMYLKLFQTPVENCWINWAMYRRYNGFQPFLYNVSTDLCQLLGNPNAISFQGLVINAIKKGSN 125

  Fly   130 LN-------DIIVCPVRVGNYSLLNSDIAENIHADGVQNGTYRFFAEIVEEIGEIAKVFALQVTS 187
            ||       ||||..:...:..|....:.:.::...::..||              ||:.:||. 
  Fly   126 LNHSCPYNHDIIVDNMEFSDDFLKTLPLPQGVYKIQLRFATY--------------KVWRVQVA- 175

  Fly   188 EVYI 191
             |:|
  Fly   176 -VFI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 25/123 (20%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.