DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33643

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:209 Identity:41/209 - (19%)
Similarity:83/209 - (39%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WISAFVLI----------RLAIEVVGSYYMEYSTSPKKAVVAIKQIHVFGESNYMKAKIYIHEDR 62
            |:..|:::          |:.::.:.:           .:...|.|...|      .::....:|
  Fly     6 WLYCFLILYCVDSAQRNFRIVVDHIST-----------KIFDTKTIETLG------CQVDQSSNR 53

  Fly    63 SHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEMMFKKN 127
            |:.:.|:.|..|:|... ..|:...|:|.|..  ::|:| .|::.|..|.....|.::. ::.|.
  Fly    54 SYVNCHMLLNREVGKFD-ARNVLDFVRPNGQE--MKLYE-GRLDACLLLGSIQKNRLVN-IYSKT 113

  Fly   128 VKLNDIIVCPVRVG-NYSLLNSDIAENIHADGVQNGTYRFFAEIVEEIGEIAKVFALQVTSEVYI 191
            .|....:.||::.. ||::.|..:.|......|.:||:|...|           |.|   ::.:|
  Fly   114 FKRFSNVECPLKANFNYTMKNLYMDEQDFPSFVPSGTFRSLIE-----------FYL---NQTFI 164

  Fly   192 VDKELDCKVRGKAL 205
            ..:.:   .|||.:
  Fly   165 ASRAI---ARGKVM 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 21/90 (23%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 19/76 (25%)

Return to query results.
Submit another query.