DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33654

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:111 Identity:22/111 - (19%)
Similarity:37/111 - (33%) Gaps:35/111 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DRSHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRIN------------FCEFLSE 113
            |:|..|.....:.....::..:.:|           |.||:..|.|            .|.||..
  Fly    37 DKSFDDFEYCYIRSANRSYKYLTLK-----------VNLFKTPRFNGYRPFMFNITLDACRFLKN 90

  Fly   114 YNTNPMMEM---MFKKNVKLN-------DIIV--CPVRVGNYSLLN 147
            .::.|:.:.   .|.....||       |:||  .|:...|:.:.|
  Fly    91 TDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 18/76 (24%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 19/88 (22%)

Return to query results.
Submit another query.