DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG14491

DIOPT Version :9

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:94 Identity:23/94 - (24%)
Similarity:41/94 - (43%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RSHFDLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEMMFKK 126
            |..|::.:|....:..  ..:|::: |.|........||.|..|:.|..||..|....:::..|.
  Fly    30 RPSFNIELQFKKPVAK--FFVNMRI-VLPRRFGDDFTLFNLSGIDGCSLLSNKNQIAFIQLGRKH 91

  Fly   127 NVKLNDIIV-CP-VRVGNYSL--LNSDIA 151
            ..:.::|.. || .:..||.:  ..||:|
  Fly    92 MDRFSNIPKRCPWPKDVNYYIRGFRSDMA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 17/60 (28%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.