DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33463

DIOPT Version :9

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:105 Identity:21/105 - (20%)
Similarity:36/105 - (34%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GSNHLIMNIKV---------RVKPEGSNAFVQLFELRRINF-CEFLSEYNTNPMMEMMFKKNVKL 130
            |....:.||.|         :..|..|..|....|...:|. |.|    |.:.:::.:..|:|..
  Fly    83 GYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPF----NHDIILDKLTAKSVYH 143

  Fly   131 NDIIVCPVRVGNYSLLNSDIAENIHADGVQNGTYRFFAEI 170
            ....:.|...|:|.|     ..|....|:....::.|..:
  Fly   144 RMTNILPFPEGDYML-----QLNWFTSGIYRVIFKVFVSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 15/76 (20%)
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.