DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and CG33463

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:105 Identity:21/105 - (20%)
Similarity:36/105 - (34%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GSNHLIMNIKV---------RVKPEGSNAFVQLFELRRINF-CEFLSEYNTNPMMEMMFKKNVKL 130
            |....:.||.|         :..|..|..|....|...:|. |.|    |.:.:::.:..|:|..
  Fly    83 GYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPF----NHDIILDKLTAKSVYH 143

  Fly   131 NDIIVCPVRVGNYSLLNSDIAENIHADGVQNGTYRFFAEI 170
            ....:.|...|:|.|     ..|....|:....::.|..:
  Fly   144 RMTNILPFPEGDYML-----QLNWFTSGIYRVIFKVFVSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 15/76 (20%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 17/78 (22%)

Return to query results.
Submit another query.