DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33630 and LOC11176036

DIOPT Version :10

Sequence 1:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_003436194.2 Gene:LOC11176036 / 11176036 VectorBaseID:AGAMI1_006310 Length:202 Species:Anopheles gambiae


Alignment Length:117 Identity:28/117 - (23%)
Similarity:46/117 - (39%) Gaps:16/117 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEMMFKKNVKLNDIIVCPVRVGN 142
            |::.:.||:..|......|  |.::.: ..||::......|..:.:::..||....|..|...||
Mosquito    83 NYVWVRIKLHYKFNTFQPF--LIDMEQ-EACEYIRNRPIIPQTDYIYETFVKRLPAIAGPCPHGN 144

  Fly   143 YSLLNSDIA----ENIHADGVQNGTYRFFAEIVEEIGEIAKVFALQVTSEVY 190
            .:.   ||.    |......:..|.||...:.| .|..:. :||    ||.|
Mosquito   145 RTY---DIVWWLEERYTPRSIPAGEYRLDMKFV-AIDNVT-LFA----SETY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33630NP_001027166.1 DM8 96..186 CDD:214778 21/93 (23%)
LOC11176036XP_003436194.2 None

Return to query results.
Submit another query.