DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33894 and his-11

DIOPT Version :9

Sequence 1:NP_001027320.1 Gene:His2B:CG33894 / 3772502 FlyBaseID:FBgn0053894 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_496892.1 Gene:his-11 / 175029 WormBaseID:WBGene00001885 Length:122 Species:Caenorhabditis elegans


Alignment Length:125 Identity:102/125 - (81%)
Similarity:111/125 - (88%) Gaps:5/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKTSGKAAKKAGKAQKNITKTDKKKKRK--RKESYAIYIYKVLKQVHPDTGISSKAMSIMNSF 63
            ||||.|.|.||||.   |.:||....|||:  |||||::|||:||||||||||:|||||||||||
 Worm     1 MPPKPSAKGAKKAA---KTVTKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSF 62

  Fly    64 VNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||:||||||||||||||||||||:||||||||||:||||||||||||||||||||||||
 Worm    63 VNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33894NP_001027320.1 H2B 33..121 CDD:197718 80/87 (92%)
his-11NP_496892.1 H2B 24..120 CDD:197718 85/95 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164933
Domainoid 1 1.000 140 1.000 Domainoid score I2949
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128594
Inparanoid 1 1.050 197 1.000 Inparanoid score I2502
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm14146
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - LDO PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.