DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33894 and h2bc14

DIOPT Version :9

Sequence 1:NP_001027320.1 Gene:His2B:CG33894 / 3772502 FlyBaseID:FBgn0053894 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_012824378.2 Gene:h2bc14 / 100135279 XenbaseID:XB-GENE-5722947 Length:126 Species:Xenopus tropicalis


Alignment Length:123 Identity:100/123 - (81%)
Similarity:108/123 - (87%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKTSGKAAKKAGKAQKNITKTDKKKKRK-RKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVN 65
            |.|::.:..|.:.||.....|.|.||:|| ||||||||:||||||||||||||||||||||||||
 Frog     4 PAKSAQRQKKGSKKAVSKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVN 68

  Fly    66 DIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |:|||||.||||||||||||||||||||||||||||||||||||||||||||||||:|
 Frog    69 DVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33894NP_001027320.1 H2B 33..121 CDD:197718 84/87 (97%)
h2bc14XP_012824378.2 H2B 28..124 CDD:197718 90/95 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4606
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128594
Inparanoid 1 1.050 193 1.000 Inparanoid score I3729
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm47745
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.