DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and SCNN1D

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001123885.2 Gene:SCNN1D / 6339 HGNCID:10601 Length:802 Species:Homo sapiens


Alignment Length:331 Identity:59/331 - (17%)
Similarity:92/331 - (27%) Gaps:151/331 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YPSGRVGVLRWLHTLW--SLFLLMYIWTGSIVKCLEFTVEIPTIEKLLYLMEFPGNMATIAILVY 82
            |.||...|..|.|..:  .|.||...|..|                                   
Human   386 YTSGVAAVQDWYHFHYVDILALLPAAWEDS----------------------------------- 415

  Fly    83 YAVLNRPLAHGAE---LQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYD 144
                     ||::   ..:.....||..:|::.       ||.|...     :|.|..||.|   
Human   416 ---------HGSQDGHFVLSCSYDGLDCQARQF-------RTFHHPT-----YGSCYTVDGV--- 456

  Fly   145 FEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLWLVMDQMRMCLKELKLLQRPPQGSTKLDACY 209
               ||.       ..||:...:|::                      |::.|:|           
Human   457 ---WTA-------QRPGITHGVGLV----------------------LRVEQQP----------- 478

  Fly   210 ESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNL-------LNSLVSIC--- 264
               ...|:....|..:|:....:|..|   .|..|.:|.|....:::       |.|....|   
Human   479 ---HLPLLSTLAGIRVMVHGRNHTPFL---GHHSFSVRPGTEATISIREDEVHRLGSPYGHCTAG 537

  Fly   265 ---VELYLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVNEQILEQKCNLCQLLNEL--- 323
               ||:.|:.|...|                     |...::|..:|::.:.|:....|:.|   
Human   538 GEGVEVELLHNTSYT---------------------RQACLVSCFQQLMVETCSCGYYLHPLPAG 581

  Fly   324 -EVCSS 328
             |.|||
Human   582 AEYCSS 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 59/331 (18%)
SCNN1DNP_001123885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..211
ENaC 219..784 CDD:273304 59/331 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.