powered by:
Protein Alignment Gr59e and ppk24
DIOPT Version :9
Sequence 1: | NP_788431.1 |
Gene: | Gr59e / 37725 |
FlyBaseID: | FBgn0041233 |
Length: | 399 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651860.2 |
Gene: | ppk24 / 43702 |
FlyBaseID: | FBgn0039839 |
Length: | 595 |
Species: | Drosophila melanogaster |
Alignment Length: | 42 |
Identity: | 14/42 - (33%) |
Similarity: | 18/42 - (42%) |
Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 TTLVFHGLCVLVDVVNYDFEFWTTWSSNSVYNLP--GLMMSL 166
|||..||.|. ..|||..:.........|..| ||:::|
Fly 244 TTLTSHGFCC---TFNYDGRYVNKRDFRQRYFGPDMGLVLTL 282
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Gr59e | NP_788431.1 |
7tm_7 |
9..381 |
CDD:285581 |
14/42 (33%) |
ppk24 | NP_651860.2 |
ASC |
65..551 |
CDD:279230 |
14/42 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4294 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.