DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and ASIC1

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_064423.2 Gene:ASIC1 / 41 HGNCID:100 Length:574 Species:Homo sapiens


Alignment Length:163 Identity:39/163 - (23%)
Similarity:53/163 - (32%) Gaps:51/163 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YAVLNRP---LAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYD 144
            |.|...|   ..:|.||.:.:|.:  |..||.|. |:..:...::....||   |.:..:|:||:
Human   360 YCVCEMPCNLTRYGKELSMVKIPS--KASAKYLA-KKFNKSEQYIGENILV---LDIFFEVLNYE 418

  Fly   145 FEFWTTWSSNSVYNLPGLMMSL------------GVLQYAQPVHFLWLVMDQMRMCLKELKLLQR 197
                 |......|.:.||:..|            ||..|.....           |    .||..
Human   419 -----TIEQKKAYEIAGLLGELLMTPVPFSCHGHGVAPYHPKAG-----------C----SLLSH 463

  Fly   198 ---PPQGSTKLDACYESAFAVLVDAGGGSALMI 227
               |||.......|       |.|.||...|.|
Human   464 EGPPPQRPFPKPCC-------LGDIGGQMGLFI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 39/163 (24%)
ASIC1NP_064423.2 ENaC 19..556 CDD:273304 39/163 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.