DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and asic4b

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_999951.1 Gene:asic4b / 407667 ZFINID:ZDB-GENE-040513-6 Length:558 Species:Danio rerio


Alignment Length:172 Identity:34/172 - (19%)
Similarity:71/172 - (41%) Gaps:35/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 HGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNSV 156
            :|.||.:.:|.:  :|.|:.|  .|..|::...:....:.  |.:..:.:||:     |......
Zfish   378 YGKELSMVKIPS--RGSARYL--SRKYQKSEEYIRDNFLI--LDIFFEALNYE-----TIEQKKA 431

  Fly   157 YNLPGLMMSLG----------VLQYAQPVHFLW-LVMDQMRMCLKELK---------LLQRPPQG 201
            |::.||:..:|          :|...:.:.::: :..::::..||..|         |:|...|.
Zfish   432 YDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVAKNKIKQLLKPKKSQKQTNQRNLIQEQIQR 496

  Fly   202 STKLDACYESAFAVLVDAGGGSALMIEEMRY-TCNLIEQVHS 242
            :..|   .|......:.||..:.:..||::. ..|.:.|.||
Zfish   497 TKNL---REQNLKAQLTAGAIATVRFEEVKVKAANDVAQPHS 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 34/172 (20%)
asic4bNP_999951.1 ASC 54..497 CDD:295594 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.