DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and ppk10

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001033894.1 Gene:ppk10 / 3885617 FlyBaseID:FBgn0065110 Length:485 Species:Drosophila melanogaster


Alignment Length:205 Identity:39/205 - (19%)
Similarity:65/205 - (31%) Gaps:74/205 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSSYWENLLLTINRFLGVYPSGRVGVLRWL---------HTLWSLFLLMYIWTGSIVKCLE---- 53
            :|.|...|.:.||.|:..:.:..:...|:|         ..||.:.|:..|:. .|:.||.    
  Fly     5 NSKYRNGLKIVINYFVLYFNNCCIHGFRYLTDSMLILFEKFLWLILLIASIYF-CIIVCLSSIDR 68

  Fly    54 ----------------FTVEIPTIE-------KLLYLMEFPGN--------------MATIAILV 81
                            :...:|::.       .:.|..::..|              :..:|...
  Fly    69 YYTKSTHIGIERNYIFWNTTLPSVTVCPVDRLNITYFADYCRNNGIKGPQRDILWDFLENLANST 133

  Fly    82 YYAVLNRPLAHGAELQIERII--TGLKGK-AKRLVYKRHGQRT--------LHLMATTLVFH--- 132
            |....|.|    ...||::||  .|||.: ...|:|.....||        :..|...:..|   
  Fly   134 YINFQNIP----QNEQIDQIIEDIGLKPEHYTELIYNLTYDRTYEPNFNERIRCMDGAMFIHVRQ 194

  Fly   133 -----GLCVL 137
                 |||.|
  Fly   195 VLTEWGLCYL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 37/198 (19%)
ppk10NP_001033894.1 ASC 22..471 CDD:279230 33/188 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.