DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr59f

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:402 Identity:88/402 - (21%)
Similarity:162/402 - (40%) Gaps:88/402 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NRFLGVYPSGRVGVLRWLHTLWSLFLLMYIWTGSIVKCLEFTVE--IPTIEKLLYLMEFPGNMAT 76
            |||.      |:..|.|:...:.||:|...|...:|.....:::  :..||..:|::    ::.:
  Fly    60 NRFY------RLVHLSWMILWYGLFVLGSYWEFVLVTTQRVSLDRYLNAIESAIYVV----HIFS 114

  Fly    77 IAILVYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTL----VFHGLCVL 137
            |.:|.:..      .:.|...:..|:|....:|    |.....||...:...|    :|..|.:.
  Fly   115 IMLLTWQC------RNWAPKLMTNIVTSDLNRA----YTIDCNRTKRFIRLQLFLVGIFACLAIF 169

  Fly   138 VDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLWLVMD-----QMRM---CLKELKL 194
            .::..:.|..:.:..|.:.|.:|.::.|:...||       :|::.     |.|:   ..:||..
  Fly   170 FNIWTHKFVVYRSILSINSYVMPNIISSISFAQY-------YLLLQGIAWRQRRLTEGLERELTH 227

  Fly   195 LQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMR-YTCNLIEQV--------HSQFLLRFGL 250
            |..|....                        ::::| :..|||:..        :|..||..|.
  Fly   228 LHSPRISE------------------------VQKIRMHHANLIDFTKAVNRTFQYSILLLFVGC 268

  Fly   251 YLVLNLLNSLVSICVELYLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVNEQILEQKCN 315
            :|..||:         |:|::...|.|...:....|..|||||||.|::..||..|:.|..:...
  Fly   269 FLNFNLV---------LFLVYQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQSIQNEHST 324

  Fly   316 LCQLLNELEVCSSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTRSLGGFIGVLMAIVIFLIQIG 380
            ...||:.:......:|.||..|::|::.::.|.: .||::.||.:.|...:.......|||:|..
  Fly   325 CLTLLSRVSYARKDIQDTITHFIIQMRTNVRQHV-VCGVINLDLKFLTTLLVASADFFIFLLQYD 388

  Fly   381 LG----NKSLMG 388
            :.    :||:.|
  Fly   389 VTYEALSKSVQG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 85/389 (22%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 84/387 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.