DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr57a

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:365 Identity:70/365 - (19%)
Similarity:119/365 - (32%) Gaps:134/365 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NMATIAIL--VYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFHGLC 135
            |:|.:.|:  :|...:|     .|.:|:                 ..|.|.|.|:      ..||
  Fly   144 NIAVLGIVTTIYLMAIN-----SAAVQV-----------------ASGHRALFLL------FALC 180

  Fly   136 VLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLWLVMDQMRMCLKELKLLQRPPQ 200
            ..:......|   |.:...::..:.|:...| :.|..||....|..   .::.::||::.|    
  Fly   181 YTIVTGGPHF---TGYVHMTLAEMLGIRFRL-LQQLLQPEFLNWRF---PQLHVQELRIRQ---- 234

  Fly   201 GSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNLLNSLVSICV 265
                                  ...||:|:.|....|.:|       :.|.|...:.:.|.....
  Fly   235 ----------------------VVSMIQELHYLIQEINRV-------YALSLWAAMAHDLAMSTS 270

  Fly   266 ELYLIF---------NFFET----------------PLWEESVLLVY--RLLWLAMHGGRI---- 299
            |||::|         |..|.                ||::..:...|  |.::.|....|:    
  Fly   271 ELYILFGQSVGIGQQNEEENGSCYRMLGYLALVMIPPLYKLLIAPFYCDRTIYEARRCLRLVEKL 335

  Fly   300 --WFILSVNEQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTRSL 362
              ||         .||.:|..|:..|  .|.|:|..|     |....:|        |.|..:.:
  Fly   336 DDWF---------PQKSSLRPLVESL--MSWRIQAKI-----QFTSGLD--------VVLSRKVI 376

  Fly   363 GGFIGVLMAIVIFLIQIGLGNKSLMGVALNR-----SNWV 397
            |.|..:|:..::.|||..:..|  ||..:.:     ..|:
  Fly   377 GLFTSILVNYLLILIQFAMTQK--MGEQIEQQKIALQEWI 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 66/342 (19%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 66/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.