DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and egas-4

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:207 Identity:44/207 - (21%)
Similarity:73/207 - (35%) Gaps:69/207 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RLVYKRHGQRTLHLMATTLVFHGLCV----LVDVVNYDFEFWTTWSSNSVYN--LPGLMMSLGVL 169
            |:.|.|.|.|           :|:|:    .|....||.::.|.....|.|.  :.|   ..|.:
 Worm   687 RVDYYRLGGR-----------YGVCINSVSEVKSYYYDGDYTTDGCLRSCYQDVVNG---DCGCM 737

  Fly   170 --QYAQPVHFLWLVMDQMRMCLKEL--------------------------KLLQRP-------- 198
              :|..|...:...:.| :.|:.||                          ||.:.|        
 Worm   738 DPRYPMPNDGISCSISQ-KTCIDELVDSRGDPSTWPECTCPLPCSQTVYTSKLSRLPYVNKIVDC 801

  Fly   199 PQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYL--VLNLL--NS 259
            .:..|...||||:....::       |.|...:....:..:..:..|.:|..||  :|::|  .|
 Worm   802 EEAYTNKTACYETFLDSVI-------LRISLPKLDYMIYSETPAMDLTKFMSYLGGILSILIGVS 859

  Fly   260 LVSICVELYLIF 271
            :||. |||:.:|
 Worm   860 IVSF-VELFFLF 870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 44/207 (21%)
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230 43/204 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.