DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and ppk

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_477232.1 Gene:ppk / 34843 FlyBaseID:FBgn0020258 Length:606 Species:Drosophila melanogaster


Alignment Length:164 Identity:33/164 - (20%)
Similarity:55/164 - (33%) Gaps:57/164 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LFLLMYIWTGSIVKCLEFTVEI-----PTIEKLLYLMEFPGNMATIA--ILVYYAVLNRPLAHGA 94
            |:.||...|  :.|.::.:|:|     |....|.|..|.......:|  |..:........|.|:
  Fly   462 LYTLMQNQT--MAKSIDESVDITCNCMPACTSLEYNFEISRAKYDVAKTIRAFREEYEHTDAIGS 524

  Fly    95 ELQI---ERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFH--GLCVLVDVVNYDFEFWTTWSSN 154
            .|.:   |...|.:|             ||:....:||:.:  |:|                   
  Fly   525 RLSVYFKEHQFTAIK-------------RTILFGVSTLISNCGGIC------------------- 557

  Fly   155 SVYNLPGLMMSLGVLQYAQPVHFLWLVMDQMRMC 188
                  ||.|.:..|.:.:.::|..     ||:|
  Fly   558 ------GLFMGISCLSFLELIYFFC-----MRIC 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 33/164 (20%)
ppkNP_477232.1 ASC 69..574 CDD:279230 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.