powered by:
Protein Alignment Gr59e and Asic3
DIOPT Version :9
Sequence 1: | NP_788431.1 |
Gene: | Gr59e / 37725 |
FlyBaseID: | FBgn0041233 |
Length: | 399 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038963092.1 |
Gene: | Asic3 / 286920 |
RGDID: | 708578 |
Length: | 564 |
Species: | Rattus norvegicus |
Alignment Length: | 87 |
Identity: | 19/87 - (21%) |
Similarity: | 33/87 - (37%) |
Gaps: | 40/87 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 KELKLLQRPPQGSTK-------------------LDACYE----------SAFAV---LVDAGG- 221
|||.:::.|.:.|.: ||..:| :|:.| |.|.||
Rat 379 KELSMVRIPSRASARYLARKYNRSESYITENVLVLDIFFEALNYEAVEQKAAYEVSELLGDIGGQ 443
Fly 222 -----GSALM--IEEMRYTCNL 236
|::|: :|.:.|.|.:
Rat 444 MGLFIGASLLTILEILDYLCEV 465
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Gr59e | NP_788431.1 |
7tm_7 |
9..381 |
CDD:285581 |
19/87 (22%) |
Asic3 | XP_038963092.1 |
ASC |
17..547 |
CDD:413546 |
19/87 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4294 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.