powered by:
Protein Alignment Gr59e and del-4
DIOPT Version :9
Sequence 1: | NP_788431.1 |
Gene: | Gr59e / 37725 |
FlyBaseID: | FBgn0041233 |
Length: | 399 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492230.2 |
Gene: | del-4 / 189033 |
WormBaseID: | WBGene00012116 |
Length: | 527 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
Similarity: | 24/68 - (35%) |
Gaps: | 13/68 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 YWENLLLTINRFL------GVYPSGRVGVLRWLHTLWSLFLL----MYIW--TGSIVKCLEFTVE 57
:|..|......|. ||...|.... |||...|.|.:: ::|| ...:...|.|:|.
Worm 4 FWTGLKYVFTDFSCWTSTHGVPHIGMANA-RWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVN 67
Fly 58 IPT 60
..|
Worm 68 TET 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4294 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.