DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr22d

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster


Alignment Length:234 Identity:51/234 - (21%)
Similarity:88/234 - (37%) Gaps:88/234 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 HGLCVLVDVVNYDFEFWTTWSSNS-VYNLPGLMMSLGVLQYAQPVHFLWLVMDQMRMCLKELKLL 195
            ||  :::||          :..|: :|.:..||..:||:.                :|...|:.|
  Fly    72 HG--IMLDV----------FQRNALLYQISSLMGVVGVVS----------------ICTVHLRTL 108

  Fly   196 QRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTC-NLIE-QVHSQFLLRFGLYLVLNL-- 256
            .|    |..|:..|             :.||:.|.:|.| |.:| .....::::.|:.:|:.|  
  Fly   109 WR----SKHLEEIY-------------NGLMLLEAKYFCSNAVECPAFDGYVIQKGVVIVVGLLA 156

  Fly   257 ---------------LNSLVSICVELYLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVN 306
                           ||.||...|:|..:.......|   .|:::||.:||            :|
  Fly   157 PWMVHFGMPDSKLPVLNVLVVSMVKLGTLLLALHYHL---GVVIIYRFVWL------------IN 206

  Fly   307 EQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQRSI 345
            .::|..   :|.|....:..|||:     ||||:|...:
  Fly   207 RELLSL---VCSLRGNHKGSSSRV-----RFLLKLYNKL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 51/234 (22%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 51/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.