DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr22c

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:461 Identity:90/461 - (19%)
Similarity:153/461 - (33%) Gaps:175/461 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WENLLLTI--NRFLGVYP---SGRVGVLRWLHTLWSLFLLMYIWTGSIVKCLEFTVEIPTIEKLL 65
            |..|..|:  :.||||:|   ..|.|.|:     .|.|||.|                       
  Fly    14 WIILKATLYSSWFLGVFPYRFDSRNGQLK-----RSRFLLFY----------------------- 50

  Fly    66 YLMEFPGNMATIAILVYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLV 130
                  |     .||.::.:|....:.|.:|.|....      |:..|.    :.|.:......|
  Fly    51 ------G-----LILNFFLLLKMVCSGGQKLGIPEAF------ARNSVL----ENTHYTTGMLAV 94

  Fly   131 FHGLCVLVDVVNYDFEFWTTWSSNSVYNLP----------------------------------G 161
            |.  ||::..:|:       |.|..|.:|.                                  |
  Fly    95 FS--CVVIHFLNF-------WGSTRVQDLANELLVLEYQQFASLNETKCPKFNSFVIQKWLSVIG 150

  Fly   162 LMMSLGVLQYAQP-----------------------VH----------FLWLVMDQMRMCLKELK 193
            |::|...:.|..|                       :|          :|||:..|:...:..||
  Fly   151 LLLSYLSIAYGLPGNNFSVEMVLINSLVQFSFNCNIMHYYIGVLLIYRYLWLINGQLLEMVTNLK 215

  Fly   194 LLQRPPQGSTKLDAC----YESAFAVLVDAGGGSALMIEEMRY--TCNLIEQVHSQFLLRFGLYL 252
            |       ...:|:.    |.|.:..|::..|   .|:....|  |..|...:.|.||..:. ::
  Fly   216 L-------DCSVDSSRIRKYLSLYRRLLELKG---YMVATYEYHMTLVLTTGLASNFLAIYS-WI 269

  Fly   253 VLNL---LNSLVSICVELYLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVNEQILEQKC 314
            ||::   :|.:..:...|:|:.|     :|.         |||::...      .:.|...:...
  Fly   270 VLDISMNINFIYLLIFPLFLLVN-----VWN---------LWLSIAAS------DLAENAGKSTQ 314

  Fly   315 NLCQLLNELEVCSSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTRSLGGFIGVLMAI--VIFLI 377
            .:.:|..:|||....|:|::|.|.| |..........||:.|::.:.  ||..::.:.  :|::|
  Fly   315 TVLKLFADLEVKDIELERSVNEFAL-LCGHCQFNFHVCGLFTINYKM--GFQMIITSFLYLIYMI 376

  Fly   378 QIGLGN 383
            |....|
  Fly   377 QFDFMN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 88/454 (19%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 88/456 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.