DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr36a

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:255 Identity:50/255 - (19%)
Similarity:107/255 - (41%) Gaps:56/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 EFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFL----WLVMDQMRMCLKELKLLQR--PPQGSTK 204
            :||.:           .::::.:.|:...:.|:    .|:..::|..:.|.::|..  |.:.:..
  Fly   165 DFWMS-----------AIINMAISQHYLVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFM 218

  Fly   205 LDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHS-QFLLRFGLYLVLNLLNSLVSICV--- 265
            ...||      |.|.....|.:..:::.....:.||.. |.::.:|.|.:.::..:.::..:   
  Fly   219 TKCCY------LADRIDNIAKLQNQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAIN 277

  Fly   266 ---ELY-------LIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVNEQILEQKCNLCQLL 320
               ||:       |:|::| ...:..::|.::.:|       :::......|:|||::......|
  Fly   278 GIEELHLSVRAAALVFSWF-LFYYTSAILNLFVML-------KLFDDHKEMERILEERTLFTSAL 334

  Fly   321 NELEVCSSRLQRTINRFLLQLQRSIDQPL--EACGIVTLDTRSLGGFIGVLMAIVIFLIQ 378
            :      .||:::.....|||.|:   ||  |...|.|:...|....||.::...|||||
  Fly   335 D------VRLEQSFESIQLQLIRN---PLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQ 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 50/255 (20%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 50/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.