DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr36b

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:400 Identity:87/400 - (21%)
Similarity:152/400 - (38%) Gaps:81/400 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VYPSGRVGVLRWLHTLWSLFLLMYIWTGSIVKCLEFTVEIPTIEKLLYLMEFPGNMATIAILVYY 83
            |:.|.|..:..::..::.|..::|.:|......|.|.......|.::.:|   ..:..:|.|:  
  Fly    33 VFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQSANKLHEYVIIIM---SGLKIVAGLI-- 92

  Fly    84 AVLNRPLAHGAELQIER-------IITGLKGKAK-RLVYKRHGQRTLHLMATTLVFHGLCVLVDV 140
            .||||.|..|..:|:.:       |...||...: .::.|......:.|:..||       .||.
  Fly    93 TVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGILLKAFISFAIELLQVTL-------SVDA 150

  Fly   141 VNYDFEFWTTWSSNSVYNLPGLMMSLGV---LQYAQPVHFLWLVM---------DQMRMCLKE-- 191
            ::          ......:.||::.|.|   :..|...|||.:::         .::||.::|  
  Fly   151 LD----------RQGTAEMMGLLVKLCVSFIMNLAISQHFLVILLIRAQYRIMNAKLRMVIEESR 205

  Fly   192 -LKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLN 255
             |..||. ..|:.....||.|  ..|.|.|       |......:::.|:...|.:: ||.....
  Fly   206 RLSFLQL-RNGAFMTRCCYLS--DQLEDIG-------EVQSQLQSMVGQLDEVFGMQ-GLMAYSE 259

  Fly   256 LLNSLVSICVELYLIFNF--FETPLWEESVLLVYRLLWLAMHGGRIWFILS--VN----EQILEQ 312
            ...|:|......|.|:.:  ....|..::.::|..|:.|        |.|.  ||    .::|:.
  Fly   260 YYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITL--------FYLDALVNCNNMLRVLDH 316

  Fly   313 KCNLCQLLNELEVCSS----RLQRTINRFLLQLQRSIDQPLE--ACGIVTLDTRSLGGFIGVLMA 371
            ..:...||.|..|.:|    ||:.:.....|||.|:   ||:  ..|:..:...|.......::.
  Fly   317 HKDFLGLLEERTVFASSLDIRLEESFESLQLQLARN---PLKINVMGMFPITRGSTAAMCASVIV 378

  Fly   372 IVIFLIQIGL 381
            ..|||||..:
  Fly   379 NSIFLIQFDM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 87/398 (22%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 87/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.