DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr59a

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:344 Identity:66/344 - (19%)
Similarity:130/344 - (37%) Gaps:78/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YLMEFPGNMATI-AILVYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHG--QRTLHLMAT 127
            |:...|..|.|| ...:.|.:::|.......:.::||:..:..:..|...|.:.  :|...|...
  Fly    68 YMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTF 132

  Fly   128 TLVFHGLCVLVDVVNYDFEFWTTWSSNSVYNL-PGLM--MSLGVLQYAQPVHF--LWLV---MDQ 184
            ||.:..|..::.|..|.      |.:.:..|| .||:  :||.:|......:|  ||.:   .|.
  Fly   133 TLTYSCLSYILAVFIYQ------WKAQNWSNLCNGLLVNISLTILFVNTFFYFTSLWHIARGYDF 191

  Fly   185 MRMCLKELKL-----LQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQF 244
            :...|.|:..     |:|..:....|.|.:.:                  :.||...|.:.:...
  Fly   192 VNQQLNEIVACQSMDLERKSKELRGLWALHRN------------------LSYTARRINKHYGPQ 238

  Fly   245 LL--RFGLYLVLNLLNSLVSICVELYLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILS--- 304
            :|  ||. |.:.:::|:.:.         ..:.|...|.|:..::        |..|:::.|   
  Fly   239 MLAMRFD-YFIFSIINACIG---------TIYSTTDQEPSLEKIF--------GSLIYWVRSFDF 285

  Fly   305 -VNEQILEQKCNLCQLLNELEV------CSSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTRSL 362
             :|:.|       |.|::|.::      ..|.:...::.:|: .:.|....|..||:..::.|..
  Fly   286 FLNDYI-------CDLVSEYQMQPKFFAPESSMSNELSSYLI-YESSTRLDLLVCGLYRVNKRKW 342

  Fly   363 GGFIGVLMAIVIFLIQIGL 381
            ...:|.::.....|.|..|
  Fly   343 LQMVGSIVVHSSMLFQFHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 65/342 (19%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 66/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.