DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr59b

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:343 Identity:63/343 - (18%)
Similarity:121/343 - (35%) Gaps:93/343 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SLFLLMYIWTGSIVKCLEFTV----------EIPTIEKLLYLMEFPGNM--ATIAILVYYAVLNR 88
            :||...|....:||..:...:          :..|..||:.:   ..|:  |...:::.|.||:|
  Fly    31 TLFSRTYALIANIVTLIMLPIVMWQVQLVFQQKKTFPKLILI---TNNVREAVSFLVILYTVLSR 92

  Fly    89 PLAHGAELQIERIITGLKGKAKRLVYKRHG--QRTLHLMATTLVF--HGLCVL------------ 137
            .....|..:::.::..|..:.||..:|..|  :|:|.::.....|  ..|||.            
  Fly    93 GFRDTAFKEMQPLLLTLFREEKRCGFKGIGGVRRSLRILLFVKFFTLSWLCVTDVLFLLYSTDAL 157

  Fly   138 --VDVVNYDFE--------------FWTTWSSNSVYN-----LPGLMMSLGVLQYAQPVHFLWLV 181
              |:|:.:.|:              |...|.....::     |..::.|....::.:..| ||| 
  Fly   158 IWVNVLRFFFKCNTNNILEMVPMGYFLALWHIARGFDCVNRRLDQIVKSKSTRKHRELQH-LWL- 220

  Fly   182 MDQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIE-------- 238
               :..||.:..|..........|.:.:::....::.|..|:.       :|.:|..        
  Fly   221 ---LHACLTKTALNINKIYAPQMLASRFDNFVNGVIQAYWGAV-------FTFDLSTPFFWVVYG 275

  Fly   239 --QVHSQFLLRFGLYLVLNLLNSLVSIC---------------VELYLIF-NFFETPLWEESVLL 285
              |.|.:.|   ..||:.|:.:..|...               :..|:|: |..:..||...:..
  Fly   276 SVQYHVRCL---DYYLIDNMCDVAVEYHDSAKHSWSEVRWTKEISSYVIYANSTKLQLWSCGLFQ 337

  Fly   286 VYRLLWLAMHGGRIWFIL 303
            ..|.:|.||....:::||
  Fly   338 ANRSMWFAMISSVLYYIL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 63/343 (18%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 63/343 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.