DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Gr28a

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:332 Identity:69/332 - (20%)
Similarity:120/332 - (36%) Gaps:103/332 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RLVYKRHGQRTLHLMATTLVFHG--------LCV----LVD-VVNYDFEFWTTWSSNSVYNLPGL 162
            :|.|:|      .|:::.|:..|        |||    ||. .::..|..:||::      ||.:
  Fly   133 KLDYRR------ILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTFA------LPHI 185

  Fly   163 MMSLGVLQYAQPV-----HFLWL---VMDQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDA 219
            .:||.|.::....     .|..|   :.|.:...:::|..|:..|..|......|......|:..
  Fly   186 NISLMVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLIST 250

  Fly   220 GGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNLLNSLVSIC--VE---------------L 267
                    ...||:...:.:::.::.::    .|.|:.|.|..||  :|               |
  Fly   251 --------PMKRYSVTSVIRLNPEYAIK----QVSNIHNLLCDICQTIEEYFTYPLLGIIAISFL 303

  Fly   268 YLIFNFF----------ETPLWEESVLLVYRLLWLAMHGGRIWFILSV-------NEQILEQKCN 315
            :::|:.|          ...::|......:.|:.|      ||:|:.:       :..||.....
  Fly   304 FILFDDFYILEAILNPKRLDVFEADEFFAFFLMQL------IWYIVIIVLIVEGSSRTILHSSYT 362

  Fly   316 LC---QLLN-----ELEVCSSRLQRTINRFLLQLQRSIDQPL-EACGIVTLDTRSLGGFIGVLMA 371
            ..   ::||     ||.   .||      |.|.||.|..:.| .|.|:..||...:....|....
  Fly   363 AAIVHKILNITDDPELR---DRL------FRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATC 418

  Fly   372 IVIFLIQ 378
            .:|.|||
  Fly   419 YLIILIQ 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 69/332 (21%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 69/332 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.