DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59e and Asic1

DIOPT Version :9

Sequence 1:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001276720.1 Gene:Asic1 / 11419 MGIID:1194915 Length:559 Species:Mus musculus


Alignment Length:184 Identity:37/184 - (20%)
Similarity:67/184 - (36%) Gaps:58/184 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 YAVLNRP---LAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFHGLCVLVDVVNYD 144
            |.|...|   ..:|.||.:.:|.:  |..||.|. |:..:...::....||   |.:..:|:||:
Mouse   391 YCVCEMPCNLTRYGKELSMVKIPS--KASAKYLA-KKFNKSEQYIGENILV---LDIFFEVLNYE 449

  Fly   145 FEFWTTWSSNSVYNLPGLMMSLG----------VLQYAQPVHFLWLVMDQMRMCLKELKLLQRPP 199
                 |......|.:.||:..:|          :|...:...:.:.|: :.|:|.:         
Mouse   450 -----TIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVI-KHRLCRR--------- 499

  Fly   200 QGSTKLDACYESAFAVLVDAGGGSALMIEE----------------MRYTCNLI 237
             |..:.:|...|       |..|.||.:::                |.|..|::
Mouse   500 -GKCQKEAKRNS-------ADKGVALSLDDVKRHNPCESLRGHPAGMTYAANIL 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 37/184 (20%)
Asic1NP_001276720.1 ASC 63..541 CDD:295594 35/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.