DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33923

DIOPT Version :9

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:133 Identity:28/133 - (21%)
Similarity:49/133 - (36%) Gaps:32/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKG 99
            ||.   :.:..:::::|.:....|.|..|:           ||...||:  :|...::.|...|.
  Fly    52 TYK---YLSLRVKLLETPITKIKINVAILQ-----------RLNGYKPF--LYNVTIDACKFYKN 100

  Fly   100 SQESIYRRWFTSMLK-VGNFATSCPIREGYYYLHGWTLDA-------NNVPSFLYL--GDYRISG 154
            .:.:...|:..|..| ..|...|||      |.|...::.       ..|...|.:  |||....
  Fly   101 QKSNPIARYLYSFFKDYSNINHSCP------YDHDIIVEKLPISHVNTQVTKVLPVPHGDYLFHS 159

  Fly   155 SFY 157
            ::|
  Fly   160 NWY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 19/86 (22%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:284008 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448020
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.