DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33690

DIOPT Version :9

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:167 Identity:35/167 - (20%)
Similarity:65/167 - (38%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVPFVLGCVVVTVVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKT-----KVIMDMILVTTLRQ 65
            ||.|:|...::...      .:||...:|:.....|.:|....||.     |.|.   :...|.|
  Fly     6 LVKFLLTLPMICFC------HVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYIS---IYAKLNQ 61

  Fly    66 G--LKAHLSFEFRLTKA--KPYQSVYQHDMNY--CALIKGSQESIYRRWFTSMLKVGNFATSCPI 124
            .  :.|.::.:||...:  ||    :.:|::|  |..:|..:..:.:.::.:..:..|...:|| 
  Fly    62 VPIVDARVTIQFRRFDSGYKP----FLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCP- 121

  Fly   125 REGYYYLHGWTLDANNVPSFLYLGDYRISGSFYYGRF 161
                 |.|...:|.      |:.|:....    :|||
  Fly   122 -----YDHDLIVDK------LFTGNLEEE----FGRF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 16/82 (20%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 19/91 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.