DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33773

DIOPT Version :9

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:132 Identity:25/132 - (18%)
Similarity:51/132 - (38%) Gaps:18/132 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGKLVPFVLGCVVVTVVIKQSGPRMTFRAGDCT---YNRSTFSNFSIQIIKT-------KVIMDM 57
            :.|.:..:|..::...:|| :..|..|...:||   .....|.|.:::.|..       |..::.
  Fly     2 SAKRINLILAILIFYSIIK-TNSRFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLNQ 65

  Fly    58 ILVTTLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKGSQES-IYRRWFTSMLKVGNFATS 121
            |.:..    :|.:.....||...:|:  :|....:.|..::..:.: :.:..|.|.....|...|
  Fly    66 IPLPR----MKVNFIMWKRLNGYRPF--LYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHS 124

  Fly   122 CP 123
            ||
  Fly   125 CP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 9/43 (21%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448018
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.