DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG33767

DIOPT Version :9

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:166 Identity:52/166 - (31%)
Similarity:94/166 - (56%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CVVVTVVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFRL 77
            |.:|:::.... ..:|..||...::.:.|.||:::|....:.|||.....:.:|||..|:.:..|
  Fly    21 CTLVSIIFVHK-LAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGLKVLLNTQISL 84

  Fly    78 TKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLDANNVP 142
            .|.:.||.::.|.::.|.::...:.::::.||.||||.|||..:||:..|:|:|..|.||::.||
  Fly    85 DKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDWKLDSHLVP 149

  Fly   143 SFLYLGDYRISGSFYYGRFKKHLYNPLLECSVEAVL 178
            .::..|||.|:..|::|:.|.......|:..|.|:|
  Fly   150 HYMLPGDYCITAHFFFGKHKSKQEEFFLDLEVYALL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 31/90 (34%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.