DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33769 and CG13193

DIOPT Version :9

Sequence 1:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:146 Identity:39/146 - (26%)
Similarity:74/146 - (50%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RSTFSNFSIQ-------------IIKTKVIMDMILVTTLRQGLKAHLSFEFRLTKAKPYQSVYQH 89
            ||.|:|.|::             ..|.::.:|:.|..||:.||:..::....:.....||:::.:
  Fly    34 RSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQTLFSY 98

  Fly    90 DMNYCALIKG-SQESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLDANNVPSFLYLGDYRIS 153
            ||:.|..::. .|.|:.:.|..::.|.||.|..|||:...|.:..:.|:.:::|.:|..|.||:.
  Fly    99 DMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPGYLPAGFYRLH 163

  Fly   154 GSFYYGRFKKHLYNPL 169
            .:.|||:.|.....|:
  Fly   164 DTNYYGKPKGRQRRPV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33769NP_001027143.1 DM8 82..173 CDD:214778 27/89 (30%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463903
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.880

Return to query results.
Submit another query.