DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33880 and HTB9

DIOPT Version :10

Sequence 1:NP_001027355.1 Gene:His2B:CG33880 / 3772496 FlyBaseID:FBgn0053880 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_190184.1 Gene:HTB9 / 823741 AraportID:AT3G45980 Length:150 Species:Arabidopsis thaliana


Alignment Length:132 Identity:90/132 - (68%)
Similarity:105/132 - (79%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKTSGKA----AKKAGKAQKNITKT-----DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSK 55
            |.:...||    |:|..||.|.:.|.     |||||.|:|  |:|.|||:|||||||||.|||||
plant    19 PVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSK 83

  Fly    56 AMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT 120
            ||.|||||:|||||::|:|:|:||.|||:.|||||||||||||:|||||||||||||||||||:|
plant    84 AMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 148

  Fly   121 SS 122
            ||
plant   149 SS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33880NP_001027355.1 HFD_H2B 33..120 CDD:467035 71/86 (83%)
HTB9NP_190184.1 valS <2..47 CDD:237855 9/27 (33%)
HFD_H2B 61..148 CDD:467035 71/86 (83%)

Return to query results.
Submit another query.