DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG14518

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:162 Identity:49/162 - (30%)
Similarity:86/162 - (53%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRKLNGYHPFLFN 84
            ::||..||:|:||:|.|..|||:.:.|..:..|:...||. |::.::|:....::.|||.|:|::
  Fly    26 KMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWLYS 89

  Fly    85 VSEEHCRVLRYPNR--LRVFYYFYTAFMPFSNINHTCPY-----NDDIYIRNCTLDDRMFAKVPL 142
            ||.:.|:.:|..|.  :|:   .:..|..:|.|||||||     ..:.|:|:..|      ..|:
  Fly    90 VSFDGCQFIRRRNNALIRI---VWELFKEYSTINHTCPYVGLQQVKNFYLRSEKL------PTPI 145

  Fly   143 PKGSYKLTLEMDDGVVNWI------SIINIHF 168
            |.|.|.|       :::|:      :..|::|
  Fly   146 PTGEYLL-------MIDWVFNKKPQAATNVYF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 27/85 (32%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.