DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33632

DIOPT Version :10

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:173 Identity:63/173 - (36%)
Similarity:99/173 - (57%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFIT 71
            |.:.::.|.:..|..||::||:.||.|.:|..|.|:.:.|.....::.|||||:|:.::.|:|..
  Fly    14 ICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGL 78

  Fly    72 YRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLDDRM 136
            |::||||.|||:|::.:.||.|:..|...:..|||..|..:||||||||||.|:     .||:..
  Fly    79 YKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDL-----VLDEMS 138

  Fly   137 FAKV--------PLPKGSYKLTLEMDDGVVNWISIINIHFEID 171
            :..:        |.|:|:|||.       |:||:     ::||
  Fly   139 YHSINYKLTEILPFPEGNYKLE-------VHWIA-----YDID 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 34/86 (40%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 34/85 (40%)

Return to query results.
Submit another query.