DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33721

DIOPT Version :10

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:157 Identity:39/157 - (24%)
Similarity:68/157 - (43%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWISLLFIG---ESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMV 66
            |::.::|.|   |:...:..||.||...|.:::.|..|.:|.:.|.....::...:.::||....
  Fly     8 LFVLVIFFGNIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNAS 72

  Fly    67 VRFITYRKLNGYHPFLFNVSEEHCRVLRYPNRLR--VFYYFYTAFMPFSNINHTCPYNDDIYIRN 129
            .:....|:...|.|.....|.:.|:.:.|...|.  :...|......::|.||.|||:.|:.|  
  Fly    73 AKLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLII-- 135

  Fly   130 CTLDDRMFAK---------VPLPKGSY 147
                ||:.:|         :|||.|.|
  Fly   136 ----DRLPSKYLSEHFTNILPLPPGDY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 24/89 (27%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 24/91 (26%)

Return to query results.
Submit another query.