DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG13590

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:172 Identity:58/172 - (33%)
Similarity:90/172 - (52%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRF 69
            |.::.|..||: .|:::||..|:||:||:||...||||...|.....||:|..:: |...:.|.|
  Fly    12 LLVAYLSCGEA-PYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-PARNISVHF 74

  Fly    70 ITYRKLNGYHPFLFNVSEEHCRVLRYPNR--LRVFYYFYTAFMPFSNINHTCPYN-----DDIYI 127
            .|.:|.|||.||||:.:.:.|..:|..|:  .::.:|.   ....|.|||||||.     .|.: 
  Fly    75 KTMKKANGYKPFLFDYTFDACEFMRRRNQPVAKIIWYM---IRNVSTINHTCPYEGLQMLSDFH- 135

  Fly   128 RNCTLDDRMFAKVPLPKGSYKLTLE-MDDGVVNWISIINIHF 168
                   ::...||||.|.|.|.:: :.||...:.:  |::|
  Fly   136 -------KVDIPVPLPSGDYLLMVDWLFDGKTQFAT--NVYF 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 28/85 (33%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472310
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.