DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33757

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:137 Identity:36/137 - (26%)
Similarity:70/137 - (51%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRKLNGYHPFLFN 84
            :..:|.|.:||:|:.....|::|.:.|.....:|..:.|: .:|.:.:|...:::.||:.|||:|
  Fly    21 KFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLR-TVNNVHMRLELFKRANGWRPFLYN 84

  Fly    85 VSEEHCRVLRYPNRLRVF--YYFYTAFMPFSNINHTCPYNDDIYIRNCTLD---DRMFAKVPLPK 144
            :|...|..|...|.:.|.  |.:...::|.:  |:|||:..:..|:...|:   ::...:.|:..
  Fly    85 ISFNLCDFLSKRNNVIVSLGYEYLKPYIPMT--NYTCPFKKNHLIKCTDLEFDIEKFRVRFPIET 147

  Fly   145 GSYKLTL 151
            |.|.|.|
  Fly   148 GEYALQL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 22/83 (27%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.