DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33644

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:131 Identity:23/131 - (17%)
Similarity:43/131 - (32%) Gaps:27/131 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVRFITYRKLN---GYHPFL 82
            :|.::|..:...:|....|||            |.|............|...:::|   |.:.|.
  Fly     5 MTQIECPIHSPEYVQNFSCRL------------HKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFS 57

  Fly    83 FNVSE----------EHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPY--NDDIYIRNCTLDDR 135
            |...:          ::|:.|.......:|..........||....||:  |...|:...|::.:
  Fly    58 FKQGKSIINYTAMEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTINPK 122

  Fly   136 M 136
            :
  Fly   123 V 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 14/82 (17%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 13/74 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.