DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33766

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:175 Identity:34/175 - (19%)
Similarity:75/175 - (42%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRMVVR--- 68
            |.|:.:......:.|...:|.::::|:  |....:.|....:   |:...||::.:..:.:.   
  Fly    13 ICLIIVPIPTNKILLLESQCGNFNRSY--FSNFTMFVKNSQM---NMEFFLLRVLVPGVTMDIEF 72

  Fly    69 FITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDI-YIRNCTL 132
            ||:.:...|:.. :|..:.:.|.:|. ..|..:|..::..|....|....||...:. |::|...
  Fly    73 FISMQNSYGFQK-IFQYTLDMCSLLA-QRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135

  Fly   133 DDRMFAKVPLPKGSYKLTLEMD-----DGVVNWISIINIHFEIDV 172
            :.....|. |..|.|::..:|:     |||..:  ::...||:::
  Fly   136 NTLFIPKF-LYAGKYRVKFDMNQLRKIDGVRYF--LVGCAFEVEI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 17/79 (22%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.