DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33679 and CG33764

DIOPT Version :9

Sequence 1:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:179 Identity:61/179 - (34%)
Similarity:106/179 - (59%) Gaps:20/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKYLLWISLL-----FIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKL 60
            :|..|:::.|     :|.|.:..|:.||::|:|.|:.|.:|....||.:.|.....::.|||||:
  Fly     3 IKLNLFVASLILLTYYITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKI 67

  Fly    61 PINRMVVRFITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDI 125
            |::::.|||..|:::|||.|||:|:|.:.||.|..||...|..|||..|..:|||||:||::.||
  Fly    68 PVSKVKVRFGLYKRVNGYMPFLYNMSFDACRFLTSPNPNPVALYFYNFFKDYSNINHSCPFDHDI 132

  Fly   126 YIRNC---TLDDRMFAKVPLPKGSYKLTLEMDDGVVNWISIINIHFEID 171
            .:...   ::::::...:|.|:|.|.:.:       :||:     ::||
  Fly   133 ILDKMPYHSINNKVTKILPFPEGKYMIEM-------HWIA-----YDID 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 32/81 (40%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:284008 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472256
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.